PRR5 anticorps
-
- Antigène Voir toutes PRR5 Anticorps
- PRR5 (Proline Rich 5 (Renal) (PRR5))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRR5 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PRR5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLDPTRSSLPRSSPENLVDQILESVDSDSEGIFIDFGRGRGSGMSDLEGS
- Top Product
- Discover our top product PRR5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRR5 Blocking Peptide, catalog no. 33R-3387, is also available for use as a blocking control in assays to test for specificity of this PRR5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRR5 (Proline Rich 5 (Renal) (PRR5))
- Autre désignation
- PRR5 (PRR5 Produits)
- Synonymes
- anticorps AU043908, anticorps Arhgap8, anticorps C030017C09Rik, anticorps C78947, anticorps Protor-1, anticorps Protor1, anticorps FLJ20185k, anticorps PP610, anticorps PROTOR-1, anticorps PROTOR1, anticorps pp610, anticorps protor1, anticorps protor2, anticorps proline rich 5 (renal), anticorps proline rich 5, anticorps proline rich 5 L homeolog, anticorps Prr5, anticorps PRR5, anticorps prr5.L
- Sujet
- This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis.
- Poids moléculaire
- 41 kDa (MW of target protein)
- Pathways
- Signalisation PI3K-Akt
-