SERPIND1 anticorps

N° du produit ABIN633840

Détail du produit anti-SERPIND1 anticorps

Antigène: SERPIND1 (serpin Peptidase Inhibitor, Clade D (Heparin Cofactor), Member 1 (SERPIND1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SERPIND1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SERPIND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SERPIND1 Blocking Peptide, catalog no. 33R-9813, is also available for use as a blocking control in assays to test for specificity of this SERPIND1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPIND1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SERPIND1

Antigène: SERPIND1 (serpin Peptidase Inhibitor, Clade D (Heparin Cofactor), Member 1 (SERPIND1))

Autre désignation: SERPIND1 (SERPIND1 Produits)

Synonymes: anticorps D22S673, anticorps HC2, anticorps HCF2, anticorps HCII, anticorps HLS2, anticorps LS2, anticorps THPH10, anticorps serpind1, anticorps MGC53936, anticorps rls2var1, anticorps AA985900, anticorps AI303446, anticorps Hcf2, anticorps serpin family D member 1, anticorps serpin peptidase inhibitor, clade D (heparin cofactor), member 1 L homeolog, anticorps serpin peptidase inhibitor, clade D (heparin cofactor), member 1, anticorps serine (or cysteine) peptidase inhibitor, clade D, member 1, anticorps SERPIND1, anticorps serpind1.L, anticorps Serpind1, anticorps serpind1

Sujet: The product encoded by this gene is a serine proteinase inhibitor which rapidly inhibits thrombin in the presence of dermatan sulfate or heparin. The gene contains five exons and four introns.

Poids moléculaire: 55 kDa (MW of target protein)