Angiopoietin 4 anticorps (N-Term)

N° du produit ABIN633842

Détail du produit anti-Angiopoietin 4 anticorps

Antigène: Angiopoietin 4 (ANGPT4)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Angiopoietin 4 est non-conjugé

Application: Western Blotting (WB)

Specificité: ANGPT4 antibody was raised against the N terminal of ANGPT4

Purification: Affinity purified

Immunogène: ANGPT4 antibody was raised using the N terminal of ANGPT4 corresponding to a region with amino acids TLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANGPT4 Blocking Peptide, catalog no. 33R-9193, is also available for use as a blocking control in assays to test for specificity of this ANGPT4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANGPT4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Angiopoietin 4

Antigène: Angiopoietin 4 (ANGPT4)

Autre désignation: ANGPT4 (ANGPT4 Produits)

Synonymes: anticorps AGP4, anticorps ANG-3, anticorps ANG4, anticorps Agpt4, anticorps Ang3, anticorps ANGPT4, anticorps agp4, anticorps ang4, anticorps ANGPTL4, anticorps angiopoietin 4, anticorps angiopoietin-4, anticorps angiopoietin 4 S homeolog, anticorps ANGPT4, anticorps Angpt4, anticorps angpt4, anticorps CpipJ_CPIJ008143, anticorps CpipJ_CPIJ016367, anticorps angpt4.S, anticorps LOC100714243

Sujet: Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Signalisation RTK