IGFBP2 anticorps (Middle Region)
-
- Antigène Voir toutes IGFBP2 Anticorps
- IGFBP2 (Insulin-Like Growth Factor Binding Protein 2, 36kDa (IGFBP2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IGFBP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IGFBP2 antibody was raised against the middle region of IGFBP2
- Purification
- Affinity purified
- Immunogène
- IGFBP2 antibody was raised using the middle region of IGFBP2 corresponding to a region with amino acids KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ
- Top Product
- Discover our top product IGFBP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IGFBP2 Blocking Peptide, catalog no. 33R-4590, is also available for use as a blocking control in assays to test for specificity of this IGFBP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFBP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IGFBP2 (Insulin-Like Growth Factor Binding Protein 2, 36kDa (IGFBP2))
- Autre désignation
- IGFBP2 (IGFBP2 Produits)
- Synonymes
- anticorps IBP2, anticorps IGF-BP53, anticorps AI255832, anticorps IBP-2, anticorps Igfbp-2, anticorps mIGFBP-2, anticorps IGFBP-2, anticorps ILGFBPA, anticorps pIGFBP-2, anticorps igfbp2, anticorps MGC65741, anticorps MGC76823, anticorps MGC174445, anticorps IGFBP2, anticorps ibp2, anticorps igf-bp53, anticorps igfbp2a, anticorps si:ch211-2k18.3, anticorps insulin like growth factor binding protein 2, anticorps insulin-like growth factor binding protein 2, anticorps insulin-like growth factor binding protein 2a, anticorps insulin-like growth factor binding protein 2b, anticorps IGFBP2, anticorps Igfbp2, anticorps igfbp2a, anticorps igfbp2, anticorps igfbp2b
- Sujet
- IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
- Poids moléculaire
- 35 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Growth Factor Binding, Activated T Cell Proliferation
-