IGFBP2 anticorps (Middle Region)

N° du produit ABIN633877

Détail du produit anti-IGFBP2 anticorps

Antigène: IGFBP2 (Insulin-Like Growth Factor Binding Protein 2, 36kDa (IGFBP2))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IGFBP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: IGFBP2 antibody was raised against the middle region of IGFBP2

Purification: Affinity purified

Immunogène: IGFBP2 antibody was raised using the middle region of IGFBP2 corresponding to a region with amino acids KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IGFBP2 Blocking Peptide, catalog no. 33R-4590, is also available for use as a blocking control in assays to test for specificity of this IGFBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IGFBP2

Antigène: IGFBP2 (Insulin-Like Growth Factor Binding Protein 2, 36kDa (IGFBP2))

Autre désignation: IGFBP2 (IGFBP2 Produits)

Synonymes: anticorps IBP2, anticorps IGF-BP53, anticorps AI255832, anticorps IBP-2, anticorps Igfbp-2, anticorps mIGFBP-2, anticorps IGFBP-2, anticorps ILGFBPA, anticorps pIGFBP-2, anticorps igfbp2, anticorps MGC65741, anticorps MGC76823, anticorps MGC174445, anticorps IGFBP2, anticorps ibp2, anticorps igf-bp53, anticorps igfbp2a, anticorps si:ch211-2k18.3, anticorps insulin like growth factor binding protein 2, anticorps insulin-like growth factor binding protein 2, anticorps insulin-like growth factor binding protein 2a, anticorps insulin-like growth factor binding protein 2b, anticorps IGFBP2, anticorps Igfbp2, anticorps igfbp2a, anticorps igfbp2, anticorps igfbp2b

Sujet: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Growth Factor Binding, Activated T Cell Proliferation