SPINK1 anticorps (N-Term)

N° du produit ABIN633881

Détail du produit anti-SPINK1 anticorps

Antigène: SPINK1 (serine Peptidase Inhibitor, Kazal Type 1 (SPINK1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPINK1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SPINK1 antibody was raised against the N terminal of SPINK1

Purification: Affinity purified

Immunogène: SPINK1 antibody was raised using the N terminal of SPINK1 corresponding to a region with amino acids KVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPINK1 Blocking Peptide, catalog no. 33R-4724, is also available for use as a blocking control in assays to test for specificity of this SPINK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPINK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPINK1

Antigène: SPINK1 (serine Peptidase Inhibitor, Kazal Type 1 (SPINK1))

Autre désignation: SPINK1 (SPINK1 Produits)

Synonymes: anticorps PCTT, anticorps PSTI, anticorps Spink3, anticorps TATI, anticorps TCP, anticorps Psti, anticorps SPINK1, anticorps p12, anticorps serine peptidase inhibitor, Kazal type 1, anticorps SPINK1, anticorps Spink1

Sujet: SPINK1 is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.

Poids moléculaire: 8 kDa (MW of target protein)