IGFBP4 anticorps (Middle Region)
-
- Antigène Voir toutes IGFBP4 Anticorps
- IGFBP4 (Insulin-Like Growth Factor Binding Protein 4 (IGFBP4))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IGFBP4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IGFBP4 antibody was raised against the middle region of IGFBP4
- Purification
- Affinity purified
- Immunogène
- IGFBP4 antibody was raised using the middle region of IGFBP4 corresponding to a region with amino acids RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV
- Top Product
- Discover our top product IGFBP4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IGFBP4 Blocking Peptide, catalog no. 33R-7813, is also available for use as a blocking control in assays to test for specificity of this IGFBP4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFBP4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IGFBP4 (Insulin-Like Growth Factor Binding Protein 4 (IGFBP4))
- Autre désignation
- IGFBP4 (IGFBP4 Produits)
- Synonymes
- anticorps IGFBP4, anticorps igfbp4, anticorps BP-4, anticorps HT29-IGFBP, anticorps IBP4, anticorps IGFBP-4, anticorps AI875747, anticorps Deb2, anticorps IGF-BP4, anticorps IBP-4, anticorps insulin like growth factor binding protein 4, anticorps insulin-like growth factor-binding protein 4, anticorps insulin-like growth factor binding protein 4, anticorps IGFBP4, anticorps LOC100136305, anticorps LOC100194498, anticorps igfbp4, anticorps Igfbp4
- Sujet
- IGFBP4 is a member of the insulin-like growth factor binding protein (IGFBP) family. IGFBP4 is a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.
- Poids moléculaire
- 26 kDa (MW of target protein)
- Pathways
- Signalisation WNT, Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process
-