IGFBP4 anticorps (Middle Region)

N° du produit ABIN633882

Détail du produit anti-IGFBP4 anticorps

Antigène: IGFBP4 (Insulin-Like Growth Factor Binding Protein 4 (IGFBP4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IGFBP4 est non-conjugé

Application: Western Blotting (WB)

Specificité: IGFBP4 antibody was raised against the middle region of IGFBP4

Purification: Affinity purified

Immunogène: IGFBP4 antibody was raised using the middle region of IGFBP4 corresponding to a region with amino acids RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IGFBP4 Blocking Peptide, catalog no. 33R-7813, is also available for use as a blocking control in assays to test for specificity of this IGFBP4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFBP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IGFBP4

Antigène: IGFBP4 (Insulin-Like Growth Factor Binding Protein 4 (IGFBP4))

Autre désignation: IGFBP4 (IGFBP4 Produits)

Synonymes: anticorps IGFBP4, anticorps igfbp4, anticorps BP-4, anticorps HT29-IGFBP, anticorps IBP4, anticorps IGFBP-4, anticorps AI875747, anticorps Deb2, anticorps IGF-BP4, anticorps IBP-4, anticorps insulin like growth factor binding protein 4, anticorps insulin-like growth factor-binding protein 4, anticorps insulin-like growth factor binding protein 4, anticorps IGFBP4, anticorps LOC100136305, anticorps LOC100194498, anticorps igfbp4, anticorps Igfbp4

Sujet: IGFBP4 is a member of the insulin-like growth factor binding protein (IGFBP) family. IGFBP4 is a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Signalisation WNT, Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process