Chromogranin A anticorps
-
- Antigène Voir toutes Chromogranin A (CHGA) Anticorps
- Chromogranin A (CHGA)
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Chromogranin A est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Chromogranin A antibody was raised using a synthetic peptide corresponding to a region with amino acids DSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ
- Top Product
- Discover our top product CHGA Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Chromogranin A Blocking Peptide, catalog no. 33R-2167, is also available for use as a blocking control in assays to test for specificity of this Chromogranin A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHGA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Chromogranin A (CHGA)
- Autre désignation
- Chromogranin A (CHGA Produits)
- Synonymes
- anticorps CGA, anticorps CG-ALPHA, anticorps FSHA, anticorps GPHA1, anticorps GPHa, anticorps HCG, anticorps LHA, anticorps TSHA, anticorps ChrA, anticorps fj05f09, anticorps si:dkey-177p2.2, anticorps wu:fj05f09, anticorps zgc:101749, anticorps zgc:56075, anticorps CHGA, anticorps cgA, anticorps chga, anticorps chromogranin A, anticorps glycoprotein hormones, alpha polypeptide, anticorps uncharacterized CHGA, anticorps chromogranin A S homeolog, anticorps CHGA, anticorps CGA, anticorps Chga, anticorps chga, anticorps chga.S
- Sujet
- CHGA is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. Its gene product is a precursor to three biologically active peptides, vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein. However, biological activities for these molecules have not been shown.
- Poids moléculaire
- 51 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion, cAMP Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling
-