-
- Antigène Voir toutes SERPINC1 Anticorps
- SERPINC1 (Serpin Family C Member 1 (SERPINC1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SERPINC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SERPINC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD
- Top Product
- Discover our top product SERPINC1 Anticorps primaire
-
anti-Serpin Family C Member 1 (SERPINC1) antibody
SERPINC1 Reactivité: Humain WB, IHC, IP, ICC Hôte: Souris Monoclonal C3 unconjugated
anti-Serpin Family C Member 1 (SERPINC1) (AA 150-426) antibodySERPINC1 Reactivité: Rat WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Serpin Family C Member 1 (SERPINC1) (AA 33-465) antibodySERPINC1 Reactivité: Boeuf (Vache) WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Serpin Family C Member 1 (SERPINC1) (AA 33-465) antibodySERPINC1 Reactivité: Rat WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Serpin Family C Member 1 (SERPINC1) (AA 364-393), (C-Term) antibodySERPINC1 Reactivité: Humain, Souris WB, IF, FACS, IHC (p) Hôte: Lapin Polyclonal RB18489 unconjugated
anti-Serpin Family C Member 1 (SERPINC1) (AA 1-259) antibodySERPINC1 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 2B12 unconjugated
anti-Serpin Family C Member 1 (SERPINC1) (AA 37-180) antibodySERPINC1 Reactivité: Humain WB, IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Serpin Family C Member 1 (SERPINC1) (AA 33-185) antibodySERPINC1 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Serpin Family C Member 1 (SERPINC1) antibodySERPINC1 Reactivité: Humain WB, IHC Hôte: Lapin Monoclonal unconjugated
anti-Serpin Family C Member 1 (SERPINC1) antibodySERPINC1 Reactivité: Humain WB, IHC, IP, ICC Hôte: Souris Monoclonal C2 unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SERPINC1 Blocking Peptide, catalog no. 33R-4150, is also available for use as a blocking control in assays to test for specificity of this SERPINC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SERPINC1 (Serpin Family C Member 1 (SERPINC1))
- Autre désignation
- SERPINC1 (SERPINC1 Produits)
- Synonymes
- anticorps AT3, anticorps AT3D, anticorps ATIII, anticorps THPH7, anticorps SERPINC1, anticorps DKFZp470C1733, anticorps AI114908, anticorps At-3, anticorps At3, anticorps ANTITHROMBIN, AT-III, anticorps AT-III, anticorps serpin family C member 1, anticorps antithrombin-III, anticorps serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1, anticorps SERPINC1, anticorps CpipJ_CPIJ000472, anticorps CpipJ_CPIJ013111, anticorps Serpinc1
- Sujet
- The protein encoded by this gene is a plasma protease inhibitor and a member of the serpin superfamily. This protein inhibits thrombin as well as other activated serine proteases of the coagulation system, and it regulates the blood coagulation cascade.
- Poids moléculaire
- 52 kDa (MW of target protein)
-
Vous êtes ici:
