FCN1 anticorps

N° du produit ABIN633978

Détail du produit anti-FCN1 anticorps

Antigène: FCN1 (Ficolin (Collagen/fibrinogen Domain Containing) 1 (FCN1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FCN1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FCN1 Blocking Peptide, catalog no. 33R-3578, is also available for use as a blocking control in assays to test for specificity of this FCN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FCN1

Antigène: FCN1 (Ficolin (Collagen/fibrinogen Domain Containing) 1 (FCN1))

Autre désignation: FCN1 (FCN1 Produits)

Synonymes: anticorps FCNM, anticorps FCNB, anticorps FCN2, anticorps FCN1, anticorps ficolin 1, anticorps ficolin (collagen/fibrinogen domain containing) 1, anticorps ficolin-1, anticorps FCN1, anticorps Fcn1, anticorps LOC100069029

Sujet: The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognise different targets, and are functionally distinct. Ficolin 1(FCN1) is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: Système du Complément