PDIA6 anticorps (Middle Region)

N° du produit ABIN633979

Détail du produit anti-PDIA6 anticorps

Antigène: PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDIA6 est non-conjugé

Application: Western Blotting (WB)

Specificité: PDIA6 antibody was raised against the middle region of PDIA6

Purification: Affinity purified

Immunogène: PDIA6 antibody was raised using the middle region of PDIA6 corresponding to a region with amino acids KLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDIA6 Blocking Peptide, catalog no. 33R-4499, is also available for use as a blocking control in assays to test for specificity of this PDIA6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDIA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDIA6

Antigène: PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))

Autre désignation: PDIA6 (PDIA6 Produits)

Synonymes: anticorps 1700015E05Rik, anticorps AL023058, anticorps C77895, anticorps CaBP5, anticorps P5, anticorps Txndc7, anticorps ERP5, anticorps TXNDC7, anticorps CaBP1, anticorps pdi-p5, anticorps erp5, anticorps pdia6, anticorps pdip5, anticorps txndc7, anticorps protein disulfide isomerase family A member 6, anticorps protein disulfide isomerase associated 6, anticorps protein disulfide isomerase family A, member 6, anticorps protein disulfide isomerase family A member 6 L homeolog, anticorps PDIA6, anticorps Pdia6, anticorps pdia6.L

Sujet: Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Cell RedoxHomeostasis