PAI1 anticorps (C-Term)

N° du produit ABIN634000

Détail du produit anti-PAI1 anticorps

Antigène: PAI1 (SERPINE1) (Plasminogen Activator Inhibitor 1 (SERPINE1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAI1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SERPINE1 antibody was raised against the C terminal of SERPINE1

Purification: Affinity purified

Immunogène: SERPINE1 antibody was raised using the C terminal of SERPINE1 corresponding to a region with amino acids VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SERPINE1 Blocking Peptide, catalog no. 33R-9703, is also available for use as a blocking control in assays to test for specificity of this SERPINE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PAI1

Antigène: PAI1 (SERPINE1) (Plasminogen Activator Inhibitor 1 (SERPINE1))

Autre désignation: SERPINE1 (SERPINE1 Produits)

Synonymes: anticorps PAI, anticorps PAI-1, anticorps PAI1, anticorps PLANH1, anticorps SERPINE1, anticorps si:ch211-138a11.1, anticorps Planh1, anticorps PAI1A, anticorps Pai1, anticorps Pai1aa, anticorps Planh, anticorps RATPAI1A, anticorps serpin family E member 1, anticorps serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 L homeolog, anticorps serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1, anticorps serine (or cysteine) peptidase inhibitor, clade E, member 1, anticorps SERPINE1, anticorps serpine1.L, anticorps serpine1, anticorps Serpine1

Sujet: SERPINE1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Signalisation p53, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagy, Smooth Muscle Cell Migration