Follistatin anticorps (Middle Region)
-
- Antigène Voir toutes Follistatin (FST) Anticorps
- Follistatin (FST)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Follistatin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FST antibody was raised against the middle region of FST
- Purification
- Affinity purified
- Immunogène
- FST antibody was raised using the middle region of FST corresponding to a region with amino acids ALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCN
- Top Product
- Discover our top product FST Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FST Blocking Peptide, catalog no. 33R-1350, is also available for use as a blocking control in assays to test for specificity of this FST antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FST antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Follistatin (FST)
- Autre désignation
- FST (FST Produits)
- Synonymes
- anticorps CG12955, anticorps CG12956, anticorps CG33466, anticorps Dmel\\CG33466, anticorps Fol1, anticorps dFS, anticorps dFol1, anticorps dfs, anticorps fs, anticorps FS, anticorps foll, anticorps xfs, anticorps FST, anticorps fst, anticorps AL033346, anticorps FOL1, anticorps Fst-288, anticorps RATFOL1, anticorps cb446, anticorps fd07h10, anticorps fst1, anticorps wu:fd07h10, anticorps Follistatin, anticorps follistatin, anticorps follistatin L homeolog, anticorps follistatin a, anticorps Fs, anticorps fst, anticorps FST, anticorps LOC100141662, anticorps fst.L, anticorps Fst, anticorps fsta
- Sujet
- Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.
- Poids moléculaire
- 35 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion
-