PLOD2 anticorps (Middle Region)

N° du produit ABIN634011

Détail du produit anti-PLOD2 anticorps

Antigène: PLOD2 (Procollagen-Lysine 2-Oxoglutarate 5-Dioxygenase 2 (PLOD2))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLOD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PLOD2 antibody was raised against the middle region of PLOD2

Purification: Affinity purified

Immunogène: PLOD2 antibody was raised using the middle region of PLOD2 corresponding to a region with amino acids IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLOD2 Blocking Peptide, catalog no. 33R-4019, is also available for use as a blocking control in assays to test for specificity of this PLOD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLOD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLOD2

Antigène: PLOD2 (Procollagen-Lysine 2-Oxoglutarate 5-Dioxygenase 2 (PLOD2))

Autre désignation: PLOD2 (PLOD2 Produits)

Synonymes: anticorps D530025C14Rik, anticorps LH2, anticorps Plod-2, anticorps TLH, anticorps procollagen lysine, 2-oxoglutarate 5-dioxygenase 2, anticorps procollagen-lysine,2-oxoglutarate 5-dioxygenase 2, anticorps Plod2, anticorps PLOD2

Sujet: PLOD2 forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links.

Poids moléculaire: 84 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome