AGR2 anticorps

N° du produit ABIN634016

Détail du produit anti-AGR2 anticorps

Antigène: AGR2 (Anterior Gradient Homolog 2 (Xenopus Laevis) (AGR2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGR2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: AGR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AGR2 Blocking Peptide, catalog no. 33R-1144, is also available for use as a blocking control in assays to test for specificity of this AGR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AGR2

Antigène: AGR2 (Anterior Gradient Homolog 2 (Xenopus Laevis) (AGR2))

Autre désignation: AGR2 (AGR2 Produits)

Synonymes: anticorps AG2, anticorps GOB-4, anticorps HAG-2, anticorps PDIA17, anticorps XAG-2, anticorps Agr2h, anticorps Gob-4, anticorps mAG-2, anticorps wu:fj29g05, anticorps zgc:112187, anticorps agr2, anticorps hag3, anticorps hag-3, anticorps bcmp11, anticorps MGC89004, anticorps XAgr2, anticorps agr2-A, anticorps anterior gradient 2, protein disulphide isomerase family member, anticorps anterior gradient 2, anticorps anterior gradient 3, protein disulphide isomerase family member, anticorps anterior gradient 2, protein disulphide isomerase family member S homeolog, anticorps AGR2, anticorps Agr2, anticorps agr2, anticorps agr3, anticorps agr2.S

Sujet: AGR2 and hAG-3, human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan. Increased AGR2 expression is a valuable prognostic factor to predict the clinical outcome of the prostate cancer patients.

Poids moléculaire: 20 kDa (MW of target protein)