RDH16 anticorps
-
- Antigène Voir toutes RDH16 Anticorps
- RDH16 (Retinol Dehydrogenase 16 (All-Trans) (RDH16))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RDH16 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- RDH16 antibody was raised using a synthetic peptide corresponding to a region with amino acids WLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDA
- Top Product
- Discover our top product RDH16 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RDH16 Blocking Peptide, catalog no. 33R-9976, is also available for use as a blocking control in assays to test for specificity of this RDH16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RDH16 (Retinol Dehydrogenase 16 (All-Trans) (RDH16))
- Autre désignation
- RDH16 (RDH16 Produits)
- Synonymes
- anticorps MGC68820, anticorps CRAD, anticorps CRAD1, anticorps Rdh6, anticorps RODH-4, anticorps SDR9C8, anticorps Rdh2, anticorps RoDHII, anticorps retinol dehydrogenase 16 (all-trans) L homeolog, anticorps retinol dehydrogenase 16 (all-trans), anticorps retinol dehydrogenase 16, anticorps rdh16.L, anticorps RDH16, anticorps rdh16, anticorps Rdh16
- Sujet
- RDH16 is an oxidoreductase with a preference for NAD. It oxidizes all-trans-retinol and 13-cis-retinol to the corresponding aldehydes. RDH16 has higher activity towards CRBP-bound retinol than with free retinol. It also oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. RDH16 can also catalyze the reverse reaction.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-