KPNA2 anticorps

N° du produit ABIN634070

Détail du produit anti-KPNA2 anticorps

Antigène: KPNA2 (Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KPNA2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Karyopherin Alpha 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Karyopherin Alpha 2 Blocking Peptide, catalog no. 33R-3602, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KPNA2

Antigène: KPNA2 (Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2))

Autre désignation: Karyopherin alpha 2 (KPNA2 Produits)

Synonymes: anticorps IPOA1, anticorps QIP2, anticorps RCH1, anticorps SRP1alpha, anticorps ima2, anticorps importin, anticorps 2410044B12Rik, anticorps PTAC58, anticorps Rch1, anticorps ipoa1, anticorps kpna2, anticorps qip2, anticorps rch1, anticorps srp1alpha, anticorps hm:zeh0389, anticorps hm:zeh0389r, anticorps zgc:113902, anticorps zgc:86945, anticorps karyopherin subunit alpha 2, anticorps importin subunit alpha-2, anticorps Importin subunit alpha-2, anticorps karyopherin (importin) alpha 2, anticorps karyopherin alpha-2 subunit like L homeolog, anticorps karyopherin alpha 2 (RAG cohort 1, importin alpha 1), anticorps KPNA2, anticorps EDI_246290, anticorps EDI_335040, anticorps ima2, anticorps Kpna2, anticorps kpna2.L, anticorps kpna2

Sujet: Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: M Phase, Protein targeting to Nucleus