XRCC2 anticorps (Middle Region)
-
- Antigène Voir toutes XRCC2 Anticorps
- XRCC2 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp XRCC2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- XRCC2 antibody was raised against the middle region of XRCC2
- Purification
- Affinity purified
- Immunogène
- XRCC2 antibody was raised using the middle region of XRCC2 corresponding to a region with amino acids CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA
- Top Product
- Discover our top product XRCC2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
XRCC2 Blocking Peptide, catalog no. 33R-1740, is also available for use as a blocking control in assays to test for specificity of this XRCC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRCC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- XRCC2 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2))
- Autre désignation
- XRCC2 (XRCC2 Produits)
- Synonymes
- anticorps XRCC2, anticorps 4921524O04Rik, anticorps 8030409M04Rik, anticorps RAD51, anticorps RecA, anticorps RGD1564823, anticorps X-ray repair cross complementing 2, anticorps X-ray repair complementing defective repair in Chinese hamster cells 2, anticorps XRCC2, anticorps Xrcc2
- Sujet
- XRCC2 is a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.
- Poids moléculaire
- 31 kDa (MW of target protein)
- Pathways
- Réparation de l'ADN
-