RPA1 anticorps (Middle Region)

N° du produit ABIN634119

Détail du produit anti-RPA1 anticorps

Antigène: RPA1 (Replication Protein A1, 70kDa (RPA1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RPA1 antibody was raised against the middle region of RPA1

Purification: Affinity purified

Immunogène: RPA1 antibody was raised using the middle region of RPA1 corresponding to a region with amino acids TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPA1 Blocking Peptide, catalog no. 33R-9194, is also available for use as a blocking control in assays to test for specificity of this RPA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPA1

Antigène: RPA1 (Replication Protein A1, 70kDa (RPA1))

Autre désignation: RPA1 (RPA1 Produits)

Synonymes: anticorps HSSB, anticorps MST075, anticorps REPA1, anticorps RF-A, anticorps RP-A, anticorps RPA70, anticorps Cb1-727, anticorps wu:fi14b08, anticorps zgc:55337, anticorps zgc:77092, anticorps RPA1, anticorps hssb, anticorps mst075, anticorps repa1, anticorps rf-a, anticorps rp-a, anticorps rpa, anticorps rpa70, anticorps LOC100230990, anticorps 5031405K23Rik, anticorps 70kDa, anticorps AA589576, anticorps AW557552, anticorps Rpa, anticorps CG9633, anticorps D-RPA70, anticorps D-SSB, anticorps DRP-A, anticorps DmRPA, anticorps Dmel\\CG9633, anticorps RPA, anticorps RPA 70, anticorps RPA 70 kDa, anticorps RpA70, anticorps Rpa-70, anticorps Ssb-70, anticorps dRP-A, anticorps dmrpa1, anticorps i164, anticorps replication protein A1, anticorps replication protein A1, 70kDa, anticorps replication protein A1 L homeolog, anticorps Replication Protein A 70, anticorps RPA1, anticorps Rpa1, anticorps rpa1, anticorps rpa1.L, anticorps RpA-70

Sujet: RPA1 plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Telomere Maintenance, Réparation de l'ADN, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA