NCAPD2 anticorps (C-Term)

N° du produit ABIN634129

Détail du produit anti-NCAPD2 anticorps

Antigène: NCAPD2 (Non-SMC Condensin I Complex, Subunit D2 (NCAPD2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NCAPD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NCAPD2 antibody was raised against the C terminal of NCAPD2

Purification: Affinity purified

Immunogène: NCAPD2 antibody was raised using the C terminal of NCAPD2 corresponding to a region with amino acids KAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSTGSRYQPL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NCAPD2 Blocking Peptide, catalog no. 33R-4246, is also available for use as a blocking control in assays to test for specificity of this NCAPD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAPD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NCAPD2

Antigène: NCAPD2 (Non-SMC Condensin I Complex, Subunit D2 (NCAPD2))

Autre désignation: NCAPD2 (NCAPD2 Produits)

Synonymes: anticorps CAP-D2, anticorps CNAP1, anticorps hCAP-D2, anticorps 2810406C15Rik, anticorps 2810465G24Rik, anticorps mKIAA0159, anticorps RGD1562596, anticorps im:6902697, anticorps si:dkey-175g20.1, anticorps wu:fc13f08, anticorps wu:fx06e10, anticorps non-SMC condensin I complex subunit D2, anticorps non-SMC condensin I complex, subunit D2, anticorps non-SMC condensin I complex subunit D2 S homeolog, anticorps condensin complex subunit 1, anticorps NCAPD2, anticorps Ncapd2, anticorps ncapd2.S, anticorps CIMG_02087, anticorps BDBG_08990, anticorps MCYG_08389, anticorps VDBG_09812, anticorps MGYG_05811, anticorps ncapd2

Sujet: NCAPD2 is the regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. NCAPD2 may target the condensin complex to DNA via its C-terminal domain.

Poids moléculaire: 157 kDa (MW of target protein)