PLK1 anticorps

N° du produit ABIN634136

Détail du produit anti-PLK1 anticorps

Antigène: PLK1 (Polo-Like Kinase 1 (PLK1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLK1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLK1 Blocking Peptide, catalog no. 33R-4619, is also available for use as a blocking control in assays to test for specificity of this PLK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLK1

Antigène: PLK1 (Polo-Like Kinase 1 (PLK1))

Autre désignation: PLK1 (PLK1 Produits)

Synonymes: anticorps PLK, anticorps STPK13, anticorps plk, anticorps PLK-1, anticorps Plx1, anticorps stpk13, anticorps Plk, anticorps cb525, anticorps cb636, anticorps ik:tdsubc_2d1, anticorps wu:fb37g11, anticorps wu:fb76g03, anticorps xx:tdsubc_2d1, anticorps polo like kinase 1, anticorps polo like kinase 1 S homeolog, anticorps polo-like kinase 1, anticorps polo-like kinase 1 (Drosophila), anticorps Serine/threonine-protein kinase plk-1, anticorps PLK1, anticorps plk1.S, anticorps plk1, anticorps Plk1, anticorps plk-1

Sujet: Serine/threonine-protein kinase that performs several important functions throughout M phase of the cell cycle, including the regulation of centrosome maturation and spindle assembly, the removal of cohesins from chromosome arms, the inactivation of APC/C inhibitors, and the regulation of mitotic exit and cytokinesis.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Cycle Cellulaire, M Phase