PLK1 anticorps

N° du produit ABIN634136

L’anticorps anti-PLK1 Polyclonal Lapin est utilisé pour la détection de PLK1 dans des échantillons de Humain et Souris. Il a été validé pour WB.

Aperçu rapide pour PLK1 anticorps (ABIN634136)

Antigène: PLK1 (Polo-Like Kinase 1 (PLK1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLK1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PLK1 anticorps

Purification: Affinity purified

Immunogène: PLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLK1 Blocking Peptide, (ABIN940005), is also available for use as a blocking control in assays to test for specificity of this PLK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLK1

Antigène: PLK1 (Polo-Like Kinase 1 (PLK1))

Autre désignation: PLK1

Sujet: Serine/threonine-protein kinase that performs several important functions throughout M phase of the cell cycle, including the regulation of centrosome maturation and spindle assembly, the removal of cohesins from chromosome arms, the inactivation of APC/C inhibitors, and the regulation of mitotic exit and cytokinesis.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Cycle Cellulaire, M Phase