14-3-3 sigma/SFN anticorps (Middle Region)
-
- Antigène Voir toutes 14-3-3 sigma/SFN (SFN) Anticorps
- 14-3-3 sigma/SFN (SFN) (Stratifin (SFN))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp 14-3-3 sigma/SFN est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SFN antibody was raised against the middle region of SFN
- Purification
- Affinity purified
- Immunogène
- SFN antibody was raised using the middle region of SFN corresponding to a region with amino acids FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT
- Top Product
- Discover our top product SFN Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SFN Blocking Peptide, catalog no. 33R-2923, is also available for use as a blocking control in assays to test for specificity of this SFN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- 14-3-3 sigma/SFN (SFN) (Stratifin (SFN))
- Autre désignation
- SFN (SFN Produits)
- Synonymes
- anticorps YWHAS, anticorps Er, anticorps Mme1, anticorps Ywhas, anticorps stratifin, anticorps SFN, anticorps Sfn
- Sujet
- SFN is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. SFN binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, SFN regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway.
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Signalisation p53, Myometrial Relaxation and Contraction
-