14-3-3 sigma/SFN anticorps (Middle Region)

N° du produit ABIN634143

Cet anticorps anti-14-3-3 sigma/SFN Polyclonal Lapin (ABIN634143) détecte spécifiquement 14-3-3 sigma/SFN dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour 14-3-3 sigma/SFN anticorps (Middle Region) (ABIN634143)

Antigène: 14-3-3 sigma/SFN (SFN) (Stratifin (SFN))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp 14-3-3 sigma/SFN est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-14-3-3 sigma/SFN anticorps

Épitope: Middle Region

Specificité: SFN antibody was raised against the middle region of SFN

Purification: Affinity purified

Immunogène: SFN antibody was raised using the middle region of SFN corresponding to a region with amino acids FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFN Blocking Peptide, (ABIN938309), is also available for use as a blocking control in assays to test for specificity of this SFN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur 14-3-3 sigma/SFN

Antigène: 14-3-3 sigma/SFN (SFN) (Stratifin (SFN))

Autre désignation: SFN

Sujet: SFN is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. SFN binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, SFN regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Signalisation p53, Myometrial Relaxation and Contraction