RPA4 anticorps (C-Term)
-
- Antigène Voir toutes RPA4 Anticorps
- RPA4 (Replication Protein A4, 30kDa (RPA4))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RPA4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RPA4 antibody was raised against the C terminal of RPA4
- Purification
- Affinity purified
- Immunogène
- RPA4 antibody was raised using the C terminal of RPA4 corresponding to a region with amino acids HQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD
- Top Product
- Discover our top product RPA4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RPA4 Blocking Peptide, catalog no. 33R-3818, is also available for use as a blocking control in assays to test for specificity of this RPA4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RPA4 (Replication Protein A4, 30kDa (RPA4))
- Autre désignation
- RPA4 (RPA4 Produits)
- Synonymes
- anticorps HSU24186, anticorps replication protein A4, anticorps RPA4
- Sujet
- Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. RPA4 is the 32 kDa subunit of the RPA, which associates with the 70- and 13 kDa subunits to form a trimeric RPA complex. Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation.
- Poids moléculaire
- 29 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication
-