UBE2C anticorps (Middle Region)
-
- Antigène Voir toutes UBE2C Anticorps
- UBE2C (Ubiquitin-Conjugating Enzyme E2C (UBE2C))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UBE2C est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UBE2 C antibody was raised against the middle region of UBE2
- Purification
- Affinity purified
- Immunogène
- UBE2 C antibody was raised using the middle region of UBE2 corresponding to a region with amino acids GTAVGSIRTSSTVCLLSGPRETQDSSKPLVWGLGWDMRLLLELTLQLFLQ
- Top Product
- Discover our top product UBE2C Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UBE2C Blocking Peptide, catalog no. 33R-3601, is also available for use as a blocking control in assays to test for specificity of this UBE2C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UBE2C (Ubiquitin-Conjugating Enzyme E2C (UBE2C))
- Autre désignation
- UBE2C (UBE2C Produits)
- Synonymes
- anticorps LOC458287, anticorps UBCH10, anticorps dJ447F3.2, anticorps 1110015A16Rik, anticorps D2Ertd695e, anticorps im:7137135, anticorps zgc:123190, anticorps ubiquitin conjugating enzyme E2 C, anticorps ubiquitin-conjugating enzyme E2C, anticorps ubiquitin conjugating enzyme E2 C L homeolog, anticorps ubiquitin conjugating enzyme E2 C S homeolog, anticorps UBE2C, anticorps NAEGRDRAFT_82946, anticorps ube2c.L, anticorps Ube2c, anticorps ube2c.S, anticorps ube2c
- Sujet
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2C is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression.
- Poids moléculaire
- 17 kDa (MW of target protein)
- Pathways
- Ubiquitin Proteasome Pathway
-