UBE2C anticorps (Middle Region)

N° du produit ABIN634158

Cet anticorps anti-UBE2C Polyclonal Lapin (ABIN634158) détecte spécifiquement UBE2C dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour UBE2C anticorps (Middle Region) (ABIN634158)

Antigène: UBE2C (Ubiquitin-Conjugating Enzyme E2C (UBE2C))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2C est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UBE2C anticorps

Épitope: Middle Region

Specificité: UBE2 C antibody was raised against the middle region of UBE2

Purification: Affinity purified

Immunogène: UBE2 C antibody was raised using the middle region of UBE2 corresponding to a region with amino acids GTAVGSIRTSSTVCLLSGPRETQDSSKPLVWGLGWDMRLLLELTLQLFLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2C Blocking Peptide, (ABIN938987), is also available for use as a blocking control in assays to test for specificity of this UBE2C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2C

Antigène: UBE2C (Ubiquitin-Conjugating Enzyme E2C (UBE2C))

Autre désignation: UBE2C

Sujet: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2C is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: Ubiquitin Proteasome Pathway