KIF2C anticorps (N-Term)
-
- Antigène Voir toutes KIF2C Anticorps
- KIF2C (Kinesin Family Member 2C (KIF2C))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KIF2C est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KIF2 C antibody was raised against the N terminal of KIF2
- Purification
- Affinity purified
- Immunogène
- KIF2 C antibody was raised using the N terminal of KIF2 corresponding to a region with amino acids LHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSELRIT
- Top Product
- Discover our top product KIF2C Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KIF2C Blocking Peptide, catalog no. 33R-5021, is also available for use as a blocking control in assays to test for specificity of this KIF2C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KIF2C (Kinesin Family Member 2C (KIF2C))
- Autre désignation
- KIF2C (KIF2C Produits)
- Synonymes
- anticorps kif2c, anticorps MGC89391, anticorps KIF2C, anticorps si:ch211-61f14.1, anticorps KNSL6, anticorps MCAK, anticorps 4930402F02Rik, anticorps ESTM5, anticorps Knsl6, anticorps X83316, anticorps KRP2, anticorps kcm1, anticorps mcak, anticorps kinesin family member 2C, anticorps kinesin family member 2C S homeolog, anticorps KIF2C, anticorps kif2c, anticorps Kif2c, anticorps kif2c.S
- Sujet
- KIF2C is a member of kinesin-like protein family. Proteins of this family are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. It is important for anaphase chromosome segregation and may be required to coordinate the onset of sister centromere separation.
- Poids moléculaire
- 81 kDa (MW of target protein)
- Pathways
- Dynamique des Microtubules
-