Cyclin B1 anticorps (Middle Region)

N° du produit ABIN634166

Détail du produit anti-Cyclin B1 anticorps

Antigène: Cyclin B1 (CCNB1)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cyclin B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Cyclin B1 antibody was raised against the middle region of CCNB1

Purification: Affinity purified

Immunogène: Cyclin B1 antibody was raised using the middle region of CCNB1 corresponding to a region with amino acids AKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cyclin B1 Blocking Peptide, catalog no. 33R-1305, is also available for use as a blocking control in assays to test for specificity of this Cyclin B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cyclin B1

Antigène: Cyclin B1 (CCNB1)

Autre désignation: Cyclin B1 (CCNB1 Produits)

Synonymes: anticorps ccnb, anticorps cycb, anticorps cb267, anticorps cycb1, anticorps wu:fa19g04, anticorps wu:fb16d01, anticorps wu:fb16e07, anticorps wu:fi21c01, anticorps ccnb1, anticorps MGC53596, anticorps CCNB, anticorps Ccnb1-rs1, anticorps Ccnb1-rs13, anticorps CycB1, anticorps Cycb-4, anticorps Cycb-5, anticorps Cycb1-rs1, anticorps cyclin B1, anticorps cyclin B1 S homeolog, anticorps ccnb1, anticorps ccnb1.2, anticorps ccnb1.S, anticorps CCNB1, anticorps Ccnb1, anticorps ccnb1.2.S

Sujet: CCNB1 is a regulatory protein involved in mitosis. CCNB1 complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Cycle Cellulaire, AMPK Signaling, Mitotic G1-G1/S Phases, M Phase