CHEK1 anticorps

N° du produit ABIN634171

Cet anticorps Lapin Polyclonal détecte spécifiquement CHEK1 dans WB et IHC. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour CHEK1 anticorps (ABIN634171)

Antigène: CHEK1 (Checkpoint Kinase 1 (CHEK1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHEK1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-CHEK1 anticorps

Purification: Affinity purified

Immunogène: CHEK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLAL

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHEK1 Blocking Peptide, (ABIN935960), is also available for use as a blocking control in assays to test for specificity of this CHEK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHEK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHEK1

Antigène: CHEK1 (Checkpoint Kinase 1 (CHEK1))

Autre désignation: CHEK1

Sujet: CHEK1 is required during normal S phase to avoid aberrantly increased initiation of DNA replication, thereby protecting against DNA breakage. Its expression is dispensable for somatic cell death and critical for sustaining G2 DNA damage checkpoint.

Poids moléculaire: 54 kDa (MW of target protein)

Pathways: Signalisation p53, Apoptose, Cycle Cellulaire, Réparation de l'ADN