CHEK1 anticorps

N° du produit ABIN634171

Détail du produit anti-CHEK1 anticorps

Antigène: CHEK1 (Checkpoint Kinase 1 (CHEK1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHEK1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: CHEK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLAL

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHEK1 Blocking Peptide, catalog no. 33R-10008, is also available for use as a blocking control in assays to test for specificity of this CHEK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHEK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHEK1

Antigène: CHEK1 (Checkpoint Kinase 1 (CHEK1))

Autre désignation: CHEK1 (CHEK1 Produits)

Synonymes: anticorps An08g10320, anticorps AO090003000441, anticorps CHK1, anticorps chk1, anticorps C85740, anticorps Chk1, anticorps rad27, anticorps id:ibd2720, anticorps zgc:56093, anticorps CHEK1, anticorps checkpoint kinase 1, anticorps serine/threonine-protein kinase chk1, anticorps serine/threonine-protein kinase Chk1, anticorps CAMK/CAMKL/CHK1 protein kinase Chk1, anticorps checkpoint kinase 1 S homeolog, anticorps CHEK1, anticorps ANI_1_2436074, anticorps AOR_1_768154, anticorps PTRG_04183, anticorps SJAG_01680, anticorps PAAG_04978, anticorps MCYG_03290, anticorps VDBG_03742, anticorps chek1.S, anticorps Chek1, anticorps chek1

Sujet: CHEK1 is required during normal S phase to avoid aberrantly increased initiation of DNA replication, thereby protecting against DNA breakage. Its expression is dispensable for somatic cell death and critical for sustaining G2 DNA damage checkpoint.

Poids moléculaire: 54 kDa (MW of target protein)

Pathways: Signalisation p53, Apoptose, Cycle Cellulaire, Réparation de l'ADN