LIG1 anticorps (Middle Region)

N° du produit ABIN634194

Détail du produit anti-LIG1 anticorps

Antigène: LIG1 (Ligase I, DNA, ATP-Dependent (LIG1))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIG1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LIG1 antibody was raised against the middle region of LIG1

Purification: Affinity purified

Immunogène: LIG1 antibody was raised using the middle region of LIG1 corresponding to a region with amino acids ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LIG1 Blocking Peptide, catalog no. 33R-1328, is also available for use as a blocking control in assays to test for specificity of this LIG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIG1

Antigène: LIG1 (Ligase I, DNA, ATP-Dependent (LIG1))

Autre désignation: LIG1 (LIG1 Produits)

Synonymes: anticorps ATLIG1, anticorps DNA ligase 1, anticorps T6D22.23, anticorps ligI, anticorps AL033288, anticorps LigI, anticorps lig1, anticorps wu:fc54a11, anticorps DNA ligase 1, anticorps DNA ligase 1, putative, anticorps ligase I, DNA, ATP-dependent L homeolog, anticorps ligase I, DNA, ATP-dependent, anticorps LIG1, anticorps PB000674.02.0, anticorps PTRG_06243, anticorps PKH_140260, anticorps lig1.L, anticorps Lig1, anticorps lig-1, anticorps lig1

Sujet: LIG1 encodes DNA ligase I, with functions in DNA replication and the base excision repair process. Mutations in LIG1 that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents.

Poids moléculaire: 102 kDa (MW of target protein)

Pathways: Telomere Maintenance, Réparation de l'ADN, DNA Replication, Synthesis of DNA