GINS2 anticorps
-
- Antigène Voir toutes GINS2 Anticorps
- GINS2 (GINS Complex Subunit 2 (Psf2 Homolog) (GINS2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GINS2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GINS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAIN
- Top Product
- Discover our top product GINS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GINS2 Blocking Peptide, catalog no. 33R-1841, is also available for use as a blocking control in assays to test for specificity of this GINS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GINS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GINS2 (GINS Complex Subunit 2 (Psf2 Homolog) (GINS2))
- Autre désignation
- GINS2 (GINS2 Produits)
- Synonymes
- anticorps pfs2, anticorps psf2, anticorps hspc037, anticorps si:dkey-265o13.3, anticorps zgc:112262, anticorps HSPC037, anticorps PSF2, anticorps Pfs2, anticorps 2210013I18Rik, anticorps 4833427B12Rik, anticorps AI323585, anticorps RGD1311055, anticorps probable DNA replication complex GINS protein PSF2, anticorps GINS complex subunit 2 (Psf2 homolog), anticorps DNA replication complex GINS protein PSF2, anticorps GINS complex subunit 2, anticorps GINS complex subunit 2 (Psf2 homolog) L homeolog, anticorps similar to C terminus of S. cerevisiae PSF2 (YJL072C) component of the GINS complex involved in DNA replication initiation; rest of gene upstream of small intron, anticorps LOC408755, anticorps gins2, anticorps psf2, anticorps GINS2, anticorps Gins2, anticorps gins2.L, anticorps PSF2
- Sujet
- The yeast heterotetrameric GINS complex is made up of Sld5, Psf1, Psf2, and Psf3. The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts.
- Poids moléculaire
- 21 kDa (MW of target protein)
- Pathways
- DNA Replication, Synthesis of DNA
-