RAD54L anticorps

N° du produit ABIN634218

Détail du produit anti-RAD54L anticorps

Antigène: RAD54L (RAD54-Like (RAD54L))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAD54L est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RAD54 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGAR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAD54L Blocking Peptide, catalog no. 33R-9897, is also available for use as a blocking control in assays to test for specificity of this RAD54L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAD54L

Antigène: RAD54L (RAD54-Like (RAD54L))

Autre désignation: RAD54L (RAD54L Produits)

Synonymes: anticorps HR54, anticorps RAD54A, anticorps hHR54, anticorps hRAD54, anticorps RAD54, anticorps zgc:56289, anticorps rad54l, anticorps MGC69368, anticorps GdRAD54, anticorps RAD54-like, anticorps RAD54L, anticorps RAD54 like, anticorps RAD54 like (S. cerevisiae), anticorps RAD54-like (S. cerevisiae), anticorps RAD54L, anticorps Rad54l, anticorps rad54l

Sujet: This protein belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination.

Poids moléculaire: 84 kDa (MW of target protein)

Pathways: Réparation de l'ADN