PAFAH1B1 anticorps (N-Term)
-
- Antigène Voir toutes PAFAH1B1 Anticorps
- PAFAH1B1 (Platelet-Activating Factor Acetylhydrolase 1b, Regulatory Subunit 1 (45kDa) (PAFAH1B1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PAFAH1B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PAFAH1 B1 antibody was raised against the N terminal of PAFAH1 1
- Purification
- Affinity purified
- Immunogène
- PAFAH1 B1 antibody was raised using the N terminal of PAFAH1 1 corresponding to a region with amino acids MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGL
- Top Product
- Discover our top product PAFAH1B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PAFAH1B1 Blocking Peptide, catalog no. 33R-6595, is also available for use as a blocking control in assays to test for specificity of this PAFAH1B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAFAH0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PAFAH1B1 (Platelet-Activating Factor Acetylhydrolase 1b, Regulatory Subunit 1 (45kDa) (PAFAH1B1))
- Autre désignation
- PAFAH1B1 (PAFAH1B1 Produits)
- Synonymes
- anticorps LIS1, anticorps LIS2, anticorps MDCR, anticorps MDS, anticorps PAFAH, anticorps LIS-1, anticorps Lis1, anticorps MMS10-U, anticorps Mdsh, anticorps Ms10u, anticorps Pafaha, anticorps lis2, anticorps mdcr, anticorps mds, anticorps pafah, anticorps pafah1b1-b, anticorps PAFAHA, anticorps Lis1a, anticorps platelet activating factor acetylhydrolase 1b regulatory subunit 1, anticorps platelet-activating factor acetylhydrolase, isoform 1b, subunit 1, anticorps platelet-activating factor acetylhydrolase 1b, regulatory subunit 1, anticorps platelet activating factor acetylhydrolase 1b regulatory subunit 1 L homeolog, anticorps platelet-activating factor acetylhydrolase 1b, regulatory subunit 1a, anticorps platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b, anticorps PAFAH1B1, anticorps Pafah1b1, anticorps pafah1b1.L, anticorps pafah1b1a, anticorps pafah1b1b
- Sujet
- This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. PAFAH1B1 is the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine).
- Poids moléculaire
- 47 kDa (MW of target protein)
- Pathways
- M Phase, Regulation of Cell Size
-