PAFAH1B1 anticorps (N-Term)

N° du produit ABIN634232

Détail du produit anti-PAFAH1B1 anticorps

Antigène: PAFAH1B1 (Platelet-Activating Factor Acetylhydrolase 1b, Regulatory Subunit 1 (45kDa) (PAFAH1B1))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAFAH1B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PAFAH1 B1 antibody was raised against the N terminal of PAFAH1 1

Purification: Affinity purified

Immunogène: PAFAH1 B1 antibody was raised using the N terminal of PAFAH1 1 corresponding to a region with amino acids MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PAFAH1B1 Blocking Peptide, catalog no. 33R-6595, is also available for use as a blocking control in assays to test for specificity of this PAFAH1B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAFAH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PAFAH1B1

Antigène: PAFAH1B1 (Platelet-Activating Factor Acetylhydrolase 1b, Regulatory Subunit 1 (45kDa) (PAFAH1B1))

Autre désignation: PAFAH1B1 (PAFAH1B1 Produits)

Synonymes: anticorps LIS1, anticorps LIS2, anticorps MDCR, anticorps MDS, anticorps PAFAH, anticorps LIS-1, anticorps Lis1, anticorps MMS10-U, anticorps Mdsh, anticorps Ms10u, anticorps Pafaha, anticorps lis2, anticorps mdcr, anticorps mds, anticorps pafah, anticorps pafah1b1-b, anticorps PAFAHA, anticorps Lis1a, anticorps platelet activating factor acetylhydrolase 1b regulatory subunit 1, anticorps platelet-activating factor acetylhydrolase, isoform 1b, subunit 1, anticorps platelet-activating factor acetylhydrolase 1b, regulatory subunit 1, anticorps platelet activating factor acetylhydrolase 1b regulatory subunit 1 L homeolog, anticorps platelet-activating factor acetylhydrolase 1b, regulatory subunit 1a, anticorps platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b, anticorps PAFAH1B1, anticorps Pafah1b1, anticorps pafah1b1.L, anticorps pafah1b1a, anticorps pafah1b1b

Sujet: This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. PAFAH1B1 is the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine).

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: M Phase, Regulation of Cell Size