PMS2 anticorps

N° du produit ABIN634259

Détail du produit anti-PMS2 anticorps

Antigène: PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. Cerevisiae) (PMS2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PMS2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PMS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids INKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PMS2 Blocking Peptide, catalog no. 33R-4074, is also available for use as a blocking control in assays to test for specificity of this PMS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PMS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PMS2

Antigène: PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. Cerevisiae) (PMS2))

Autre désignation: PMS2 (PMS2 Produits)

Synonymes: anticorps HNPCC4, anticorps PMS2CL, anticorps PMSL2, anticorps AW555130, anticorps Pmsl2, anticorps PMS1 homolog 2, mismatch repair system component, anticorps PMS1 homolog2, mismatch repair system component, anticorps mismatch repair endonuclease PMS2, anticorps PMS2, anticorps Pms2, anticorps LOC463257, anticorps LOC107984056

Sujet: PMS2 is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors.

Poids moléculaire: 96 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Production of Molecular Mediator of Immune Response