PARK7/DJ1 anticorps

N° du produit ABIN634300

Détail du produit anti-PARK7/DJ1 anticorps

Antigène: PARK7/DJ1 (PARK7) (Parkinson Protein 7 (PARK7))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PARK7/DJ1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PARK7 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PARK7 Blocking Peptide, catalog no. 33R-9402, is also available for use as a blocking control in assays to test for specificity of this PARK7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARK7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PARK7/DJ1

Antigène: PARK7/DJ1 (PARK7) (Parkinson Protein 7 (PARK7))

Autre désignation: PARK7 (PARK7 Produits)

Synonymes: anticorps DJ-1, anticorps DJ1, anticorps CAP1, anticorps Dj1, anticorps SP22, anticorps dj1, anticorps zgc:103725, anticorps park7b, anticorps park7, anticorps park7a, anticorps Parkinsonism associated deglycase, anticorps Parkinson disease (autosomal recessive, early onset) 7, anticorps parkinson protein 7, anticorps parkinson protein 7 S homeolog, anticorps parkinson protein 7 L homeolog, anticorps PARK7, anticorps Park7, anticorps park7, anticorps park7.S, anticorps park7.L

Sujet: PARK7 belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7.

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Proton Transport