COL4a3 anticorps

N° du produit ABIN634306

Détail du produit anti-COL4a3 anticorps

Antigène: COL4a3 (COL4A3) (Collagen, Type IV, alpha 3 (COL4A3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COL4a3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Collagen Type IV alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Collagen Type IV alpha 3 Blocking Peptide, catalog no. 33R-7287, is also available for use as a blocking control in assays to test for specificity of this Collagen Type IV alpha 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COL0 0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COL4a3

Antigène: COL4a3 (COL4A3) (Collagen, Type IV, alpha 3 (COL4A3))

Autre désignation: Collagen Type IV alpha 3 (COL4A3 Produits)

Synonymes: anticorps zTumstatin, anticorps [a]3(IV), anticorps alpha3(IV), anticorps collagen type IV alpha 3 chain, anticorps collagen, type IV, alpha 3, anticorps COL4A3, anticorps col4a3, anticorps Col4a3

Sujet: This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Two transcripts exist for this gene.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Positive Regulation of Endopeptidase Activity