CRLF1 anticorps (Middle Region)
-
- Antigène Voir toutes CRLF1 Anticorps
- CRLF1 (Cytokine Receptor-Like Factor 1 (CRLF1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CRLF1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CRLF1 antibody was raised against the middle region of CRLF1
- Purification
- Affinity purified
- Immunogène
- CRLF1 antibody was raised using the middle region of CRLF1 corresponding to a region with amino acids QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGL
- Top Product
- Discover our top product CRLF1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CRLF1 Blocking Peptide, catalog no. 33R-7646, is also available for use as a blocking control in assays to test for specificity of this CRLF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRLF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CRLF1 (Cytokine Receptor-Like Factor 1 (CRLF1))
- Autre désignation
- CRLF1 (CRLF1 Produits)
- Synonymes
- anticorps CRLF1, anticorps CISS, anticorps CISS1, anticorps CLF, anticorps CLF-1, anticorps NR6, anticorps zcytor5, anticorps CRLM3, anticorps NR6.1, anticorps clf-1.a, anticorps wu:fd24a10, anticorps zgc:91992, anticorps cytokine receptor like factor 1, anticorps cytokine receptor-like factor 1, anticorps cytokine receptor-like factor 1a, anticorps CRLF1, anticorps Crlf1, anticorps crlf1a
- Sujet
- CRLF1 belongs to the type I cytokine receptor family. It is cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. The protein may be involved in nervous system development. Defects in CRLF1 are the cause of cold-induced sweating syndrome 1 and Crisponi syndrome.
- Poids moléculaire
- 46 kDa (MW of target protein)
-