RAB27A anticorps (Middle Region)

N° du produit ABIN634343

L’anticorps anti-RAB27A Polyclonal Lapin est utilisé pour la détection de RAB27A dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour RAB27A anticorps (Middle Region) (ABIN634343)

Antigène: RAB27A (RAB27A, Member RAS Oncogene Family (RAB27A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB27A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAB27A anticorps

Épitope: Middle Region

Specificité: RAB27 A antibody was raised against the middle region of RAB27

Purification: Affinity purified

Immunogène: RAB27 A antibody was raised using the middle region of RAB27 corresponding to a region with amino acids SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB27A Blocking Peptide, (ABIN5615702), is also available for use as a blocking control in assays to test for specificity of this RAB27A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB27A

Antigène: RAB27A (RAB27A, Member RAS Oncogene Family (RAB27A))

Autre désignation: RAB27A

Sujet: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism