RAB27A anticorps (Middle Region)

N° du produit ABIN634343

Détail du produit anti-RAB27A anticorps

Antigène: RAB27A (RAB27A, Member RAS Oncogene Family (RAB27A))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB27A est non-conjugé

Application: Western Blotting (WB)

Specificité: RAB27 A antibody was raised against the middle region of RAB27

Purification: Affinity purified

Immunogène: RAB27 A antibody was raised using the middle region of RAB27 corresponding to a region with amino acids SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB27A Blocking Peptide, catalog no. 33R-8704, is also available for use as a blocking control in assays to test for specificity of this RAB27A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB27A

Antigène: RAB27A (RAB27A, Member RAS Oncogene Family (RAB27A))

Autre désignation: RAB27A (RAB27A Produits)

Synonymes: anticorps MGC80943, anticorps RAB27A, anticorps gs2, anticorps ram, anticorps rab27, anticorps MGC89827, anticorps hst18676, anticorps zgc:114135, anticorps GS2, anticorps HsT18676, anticorps RAB27, anticorps RAM, anticorps 2210402C08Rik, anticorps 2410003M20Rik, anticorps 4933437C11Rik, anticorps ash, anticorps RAB27A, member RAS oncogene family L homeolog, anticorps RAB27A, member RAS oncogene family, anticorps RAB27A, member RAS oncogene family S homeolog, anticorps rab27a.L, anticorps RAB27A, anticorps rab27a, anticorps rab27a.S, anticorps Rab27a

Sujet: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism