FYN anticorps (N-Term)

N° du produit ABIN634345

Cet anticorps Lapin Polyclonal détecte spécifiquement FYN dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour FYN anticorps (N-Term) (ABIN634345)

Antigène: FYN (FYN Oncogene Related To SRC, FGR, YES (FYN))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FYN est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FYN anticorps

Épitope: N-Term

Specificité: FYN antibody was raised against the N terminal of FYN

Purification: Affinity purified

Immunogène: FYN antibody was raised using the N terminal of FYN corresponding to a region with amino acids GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FYN Blocking Peptide, (ABIN938579), is also available for use as a blocking control in assays to test for specificity of this FYN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FYN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FYN

Antigène: FYN (FYN Oncogene Related To SRC, FGR, YES (FYN))

Autre désignation: FYN

Sujet: FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.

Poids moléculaire: 54 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Feeding Behaviour, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Activated T Cell Proliferation, Thromboxane A2 Receptor Signaling