NEK6 anticorps

N° du produit ABIN634350

Détail du produit anti-NEK6 anticorps

Antigène: NEK6 (NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NEK6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NEK6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NEK6 Blocking Peptide, catalog no. 33R-3041, is also available for use as a blocking control in assays to test for specificity of this NEK6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NEK6

Antigène: NEK6 (NIMA (Never in Mitosis Gene A)-Related Kinase 6 (NEK6))

Autre désignation: NEK6 (NEK6 Produits)

Synonymes: anticorps 1300007C09Rik, anticorps si:ch211-167p9.4, anticorps ATNEK5, anticorps MOE17.17, anticorps NIMA-RELATED KINASE5, anticorps NIMA-related kinase 5, anticorps SID6-1512, anticorps NIMA (never in mitosis gene a)-related expressed kinase 6, anticorps NIMA-related kinase 6, anticorps NIMA related kinase 6, anticorps Serine/Threonine kinase catalytic domain protein, anticorps NIMA-related kinase 6 S homeolog, anticorps Nek6, anticorps nek6, anticorps NEK6, anticorps NEK5, anticorps nek6.S

Sujet: The Aspergillus nidulans 'never in mitosis A' (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA.

Poids moléculaire: 36 kDa (MW of target protein)