TOLLIP anticorps (C-Term)

N° du produit ABIN634351

Détail du produit anti-TOLLIP anticorps

Antigène: TOLLIP (Toll Interacting Protein (TOLLIP))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TOLLIP est non-conjugé

Application: Western Blotting (WB)

Specificité: TOLLIP antibody was raised against the C terminal of TOLLIP

Purification: Affinity purified

Immunogène: TOLLIP antibody was raised using the C terminal of TOLLIP corresponding to a region with amino acids MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TOLLIP Blocking Peptide, catalog no. 33R-5792, is also available for use as a blocking control in assays to test for specificity of this TOLLIP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOLLIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TOLLIP

Antigène: TOLLIP (Toll Interacting Protein (TOLLIP))

Autre désignation: TOLLIP (TOLLIP Produits)

Synonymes: anticorps IL-1RAcPIP, anticorps 4930403G24Rik, anticorps 4931428G15Rik, anticorps fk22a02, anticorps im:7145391, anticorps wu:fk22a02, anticorps zgc:76985, anticorps TOLLIP, anticorps GB17961, anticorps tollip, anticorps tollip1, anticorps tollipa, anticorps TOLIP, anticorps toll interacting protein, anticorps toll-interacting protein, anticorps toll-interacting protein-like, anticorps toll interacting protein L homeolog, anticorps toll interacting protein S homeolog, anticorps Toll-interleukine I receptor interacting protein I, anticorps TOLLIP, anticorps Tollip, anticorps tollip, anticorps LOC552034, anticorps LOC100169858, anticorps tollip.L, anticorps tollip.S, anticorps LOC100136122

Sujet: TOLLIP is component of the signaling pathway of IL-1 and Toll-like receptors. It Inhibits cell activation by microbial products. It also recruits IRAK1 to the IL-1 receptor complex and inhibits IRAK1 phosphorylation and kinase activity.

Poids moléculaire: 30 kDa (MW of target protein)