DOCK2 anticorps (Middle Region)

N° du produit ABIN634376

Détail du produit anti-DOCK2 anticorps

Antigène: DOCK2 (Dedicator of Cytokinesis 2 (DOCK2))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DOCK2 est non-conjugé

Application: Western Blotting (WB)

Specificité: DOCK2 antibody was raised against the middle region of DOCK2

Purification: Affinity purified

Immunogène: DOCK2 antibody was raised using the middle region of DOCK2 corresponding to a region with amino acids ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA

Information d'application

Indications d'application: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DOCK2 Blocking Peptide, catalog no. 33R-1320, is also available for use as a blocking control in assays to test for specificity of this DOCK2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOCK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DOCK2

Antigène: DOCK2 (Dedicator of Cytokinesis 2 (DOCK2))

Autre désignation: DOCK2 (DOCK2 Produits)

Synonymes: anticorps AI662014, anticorps AW122239, anticorps CED-5, anticorps Hch, anticorps MBC, anticorps dedicator of cytokinesis 2, anticorps dedicator of cyto-kinesis 2, anticorps DOCK2, anticorps dock2, anticorps Dock2

Sujet: The DOCK2 gene encodes a hematopoietic cell-specific CDM family protein that is indispensable for lymphocyte chemotaxis.

Poids moléculaire: 212 kDa (MW of target protein)