TIRAP anticorps
-
- Antigène Voir toutes TIRAP Anticorps
- TIRAP (Toll-Interleukin 1 Receptor (TIR) Domain Containing Adaptor Protein (TIRAP))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TIRAP est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TIRAP antibody was raised using a synthetic peptide corresponding to a region with amino acids LEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPW
- Top Product
- Discover our top product TIRAP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TIRAP Blocking Peptide, catalog no. 33R-4901, is also available for use as a blocking control in assays to test for specificity of this TIRAP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIRAP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TIRAP (Toll-Interleukin 1 Receptor (TIR) Domain Containing Adaptor Protein (TIRAP))
- Autre désignation
- TIRAP (TIRAP Produits)
- Synonymes
- anticorps mal, anticorps wyatt, anticorps BACTS1, anticorps Mal, anticorps MyD88-2, anticorps AA407980, anticorps C130027E04Rik, anticorps Tlr4ap, anticorps Wyatt, anticorps toll-interleukin 1 receptor (TIR) domain containing adaptor protein, anticorps TIR domain containing adaptor protein, anticorps toll-interleukin 1 receptor (TIR) domain containing adaptor protein L homeolog, anticorps toll-interleukin 1 receptor (TIR) domain-containing adaptor protein, anticorps tirap, anticorps TIRAP, anticorps tirap.L, anticorps Tirap
- Sujet
- The innate immune system recognises microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns.
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- Signalisation TLR, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades
-