TIRAP anticorps

N° du produit ABIN634400

L’anticorps anti-TIRAP Polyclonal Lapin est utilisé pour la détection de TIRAP dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour TIRAP anticorps (ABIN634400)

Antigène: TIRAP (Toll-Interleukin 1 Receptor (TIR) Domain Containing Adaptor Protein (TIRAP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TIRAP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TIRAP anticorps

Purification: Affinity purified

Immunogène: TIRAP antibody was raised using a synthetic peptide corresponding to a region with amino acids LEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TIRAP Blocking Peptide, (ABIN940287), is also available for use as a blocking control in assays to test for specificity of this TIRAP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIRAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TIRAP

Antigène: TIRAP (Toll-Interleukin 1 Receptor (TIR) Domain Containing Adaptor Protein (TIRAP))

Autre désignation: TIRAP

Sujet: The innate immune system recognises microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Signalisation TLR, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades