OAS1 anticorps (N-Term)

N° du produit ABIN634460

Détail du produit anti-OAS1 anticorps

Antigène: OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OAS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: OAS1 antibody was raised against the N terminal of OAS1

Purification: Affinity purified

Immunogène: OAS1 antibody was raised using the N terminal of OAS1 corresponding to a region with amino acids MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OAS1 Blocking Peptide, catalog no. 33R-6228, is also available for use as a blocking control in assays to test for specificity of this OAS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OAS1

Antigène: OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))

Autre désignation: OAS1 (OAS1 Produits)

Synonymes: anticorps OAS1, anticorps IFI-4, anticorps OIAS, anticorps OIASI, anticorps L3, anticorps Pp2a2, anticorps 2',5'-oligoadenylate synthetase 1, anticorps 2'-5'-oligoadenylate synthetase 1, anticorps 2'-5' oligoadenylate synthetase 1A, anticorps protein phosphatase 2 catalytic subunit beta, anticorps OAS1, anticorps Oas1a, anticorps Ppp2cb, anticorps Oas1

Sujet: This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Hepatitis C