PRKRA anticorps (N-Term)

N° du produit ABIN634470

Détail du produit anti-PRKRA anticorps

Antigène: PRKRA (Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRKRA est non-conjugé

Application: Western Blotting (WB)

Specificité: PRKRA antibody was raised against the N terminal of PRKRA

Purification: Affinity purified

Immunogène: PRKRA antibody was raised using the N terminal of PRKRA corresponding to a region with amino acids MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRKRA Blocking Peptide, catalog no. 33R-6483, is also available for use as a blocking control in assays to test for specificity of this PRKRA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKRA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRKRA

Antigène: PRKRA (Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA))

Autre désignation: PRKRA (PRKRA Produits)

Synonymes: anticorps PRKRA, anticorps AV120107, anticorps PRK, anticorps Pact, anticorps RAX, anticorps lear, anticorps DYT16, anticorps PACT, anticorps im:7151758, anticorps zgc:162619, anticorps dyt16, anticorps pact, anticorps prkra-a, anticorps prkra-b, anticorps rax, anticorps rbpa, anticorps protein activator of interferon induced protein kinase EIF2AK2, anticorps protein kinase, interferon inducible double stranded RNA dependent activator, anticorps protein kinase, interferon-inducible double stranded RNA dependent activator, anticorps protein activator of interferon induced protein kinase EIF2AK2 L homeolog, anticorps PRKRA, anticorps Prkra, anticorps prkra, anticorps prkra.L

Sujet: PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways