PRKRA anticorps (N-Term)
-
- Antigène Voir toutes PRKRA Anticorps
- PRKRA (Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRKRA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PRKRA antibody was raised against the N terminal of PRKRA
- Purification
- Affinity purified
- Immunogène
- PRKRA antibody was raised using the N terminal of PRKRA corresponding to a region with amino acids MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIP
- Top Product
- Discover our top product PRKRA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRKRA Blocking Peptide, catalog no. 33R-6483, is also available for use as a blocking control in assays to test for specificity of this PRKRA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKRA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRKRA (Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA))
- Autre désignation
- PRKRA (PRKRA Produits)
- Synonymes
- anticorps PRKRA, anticorps AV120107, anticorps PRK, anticorps Pact, anticorps RAX, anticorps lear, anticorps DYT16, anticorps PACT, anticorps im:7151758, anticorps zgc:162619, anticorps dyt16, anticorps pact, anticorps prkra-a, anticorps prkra-b, anticorps rax, anticorps rbpa, anticorps protein activator of interferon induced protein kinase EIF2AK2, anticorps protein kinase, interferon inducible double stranded RNA dependent activator, anticorps protein kinase, interferon-inducible double stranded RNA dependent activator, anticorps protein activator of interferon induced protein kinase EIF2AK2 L homeolog, anticorps PRKRA, anticorps Prkra, anticorps prkra, anticorps prkra.L
- Sujet
- PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).
- Poids moléculaire
- 34 kDa (MW of target protein)
- Pathways
- Regulatory RNA Pathways
-