ATP2C1 anticorps (C-Term)

N° du produit ABIN634534

Détail du produit anti-ATP2C1 anticorps

Antigène: ATP2C1 (ATPase, Ca++ Transporting, Type 2C, Member 1 (ATP2C1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP2C1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ATP2 C1 antibody was raised against the C terminal of ATP2 1

Purification: Affinity purified

Immunogène: ATP2 C1 antibody was raised using the C terminal of ATP2 1 corresponding to a region with amino acids TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILGLA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP2C1 Blocking Peptide, catalog no. 33R-9151, is also available for use as a blocking control in assays to test for specificity of this ATP2C1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP2C1

Antigène: ATP2C1 (ATPase, Ca++ Transporting, Type 2C, Member 1 (ATP2C1))

Autre désignation: ATP2C1 (ATP2C1 Produits)

Synonymes: anticorps ATP2C1, anticorps ATP2C1A, anticorps BCPM, anticorps HHD, anticorps PMR1, anticorps SPCA1, anticorps hSPCA1, anticorps Spca1, anticorps si:dkey-11p23.6, anticorps SPCA, anticorps 1700121J11Rik, anticorps AW061228, anticorps D930003G21Rik, anticorps pmr1, anticorps ATPase secretory pathway Ca2+ transporting 1, anticorps ATPase, Ca++ transporting, type 2C, member 1, anticorps ATPase, Ca++-sequestering, anticorps ATP2C1, anticorps atp2c1, anticorps Atp2c1

Sujet: ATP2C1 belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.

Poids moléculaire: 98 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Ribonucleoside Biosynthetic Process