KLRA1 anticorps (N-Term)

N° du produit ABIN634535

Détail du produit anti-KLRA1 anticorps

Antigène: KLRA1 (Killer Cell Lectin-Like Receptor, Subfamily A, Member 1 (KLRA1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLRA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KLRA1 antibody was raised against the N terminal of KLRA1

Purification: Affinity purified

Immunogène: KLRA1 antibody was raised using the N terminal of KLRA1 corresponding to a region with amino acids NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLRA1 Blocking Peptide, catalog no. 33R-6660, is also available for use as a blocking control in assays to test for specificity of this KLRA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLRA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLRA1

Antigène: KLRA1 (Killer Cell Lectin-Like Receptor, Subfamily A, Member 1 (KLRA1))

Autre désignation: KLRA1 (KLRA1 Produits)

Synonymes: anticorps Klra2, anticorps Ly49i8, anticorps A1, anticorps Klra22, anticorps Ly49a, anticorps Ly49o<129>, anticorps Ly49v, anticorps LY49, anticorps KLRA1, anticorps Ly49, anticorps killer cell lectin-like receptor, subfamily A, member 1, anticorps killer cell lectin-like receptor subfamily A, member 1, anticorps Klra1, anticorps KLRA1, anticorps LY49

Sujet: Ly-49 Receptors or killer cell lectin-like receptor subfamily A (KLRA), member 1, are a class of natural killer cell receptor. Ly-49 proteins are a diverse set of C-type lectins that are expressed on NK cells in some mammals, including rodents but not humans. Their primary function is to bind host MHC class I as a mechanism of self/health recognition. Upon binding ligands, most Ly-49 receptors will deliver an inhibitory signal, preventing killing of the target cell.

Poids moléculaire: 25 kDa (MW of target protein)