CCR2 anticorps
-
- Antigène Voir toutes CCR2 Anticorps
- CCR2 (Chemokine (C-C Motif) Receptor 2 (CCR2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CCR2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CCR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL
- Top Product
- Discover our top product CCR2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CCR2 Blocking Peptide, catalog no. 33R-5054, is also available for use as a blocking control in assays to test for specificity of this CCR2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CCR2 (Chemokine (C-C Motif) Receptor 2 (CCR2))
- Autre désignation
- CCR2 (CCR2 Produits)
- Synonymes
- anticorps CC-CKR-2, anticorps CCR-2, anticorps CCR2A, anticorps CCR2B, anticorps CD192, anticorps CKR2, anticorps CKR2A, anticorps CKR2B, anticorps CMKBR2, anticorps MCP-1-R, anticorps ACKR5, anticorps CKRX, anticorps CRAM, anticorps CRAM-A, anticorps CRAM-B, anticorps HCR, anticorps Cc-ckr-2, anticorps Ccr2a, anticorps Ccr2b, anticorps Ckr2, anticorps Ckr2a, anticorps Ckr2b, anticorps Cmkbr2, anticorps mJe-r, anticorps C-C motif chemokine receptor 2, anticorps C-C motif chemokine receptor like 2, anticorps chemokine (C-C motif) receptor 2, anticorps CCR2, anticorps CCRL2, anticorps Ccr2, anticorps LOC484790
- Sujet
- This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase.
- Poids moléculaire
- 42 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
-