SLC20A1 anticorps

N° du produit ABIN634562

Détail du produit anti-SLC20A1 anticorps

Antigène: SLC20A1 (Solute Carrier Family 20 (Phosphate Transporter), Member 1 (SLC20A1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC20A1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC20 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC20A1 Blocking Peptide, catalog no. 33R-5497, is also available for use as a blocking control in assays to test for specificity of this SLC20A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC20A1

Antigène: SLC20A1 (Solute Carrier Family 20 (Phosphate Transporter), Member 1 (SLC20A1))

Autre désignation: SLC20A1 (SLC20A1 Produits)

Synonymes: anticorps SLC20A1, anticorps DKFZp459N1424, anticorps Glvr-1, anticorps pit1, anticorps slc20a1, anticorps xSLC20A1, anticorps GLVR1, anticorps PIT1, anticorps PiT-1, anticorps AI607883, anticorps Glvr1, anticorps solute carrier family 20 member 1, anticorps solute carrier family 20 member 1 L homeolog, anticorps solute carrier family 20, member 1, anticorps SLC20A1, anticorps slc20a1.L, anticorps Slc20a1

Sujet: Retrovirus receptors allow infection of human and murine cells by various retroviruses. The receptors that have been identified at the molecular level include CD4 for human immunodeficiency virus, Rec1 for murine ecotropic virus, and GLVR1 for gibbon ape leukemia virus. These 3 proteins show no homology to one another at the DNA or protein level. GLVR1 is a sodium-dependent phosphate symporter.

Poids moléculaire: 74 kDa (MW of target protein)