ELMO3 anticorps (Middle Region)
-
- Antigène Voir toutes ELMO3 Anticorps
- ELMO3 (Engulfment and Cell Motility 3 (ELMO3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ELMO3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ELMO3 antibody was raised against the middle region of ELMO3
- Purification
- Affinity purified
- Immunogène
- ELMO3 antibody was raised using the middle region of ELMO3 corresponding to a region with amino acids RKLGFSNSNPAQDLERVPPGLLALDNMLYFSRNAPSAYSRFVLENSSRED
- Top Product
- Discover our top product ELMO3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ELMO3 Blocking Peptide, catalog no. 33R-8001, is also available for use as a blocking control in assays to test for specificity of this ELMO3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELMO3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ELMO3 (Engulfment and Cell Motility 3 (ELMO3))
- Autre désignation
- ELMO3 (ELMO3 Produits)
- Synonymes
- anticorps TMEM208, anticorps ELMO3, anticorps CED-12, anticorps CED12, anticorps ELMO-3, anticorps 9930107J06, anticorps BC058752, anticorps Ced12, anticorps transmembrane protein 208, anticorps engulfment and cell motility 3, anticorps TMEM208, anticorps ELMO3, anticorps elmo3, anticorps Elmo3
- Sujet
- ELMO3 is similar to a C. elegans protein that functions in phagocytosis of apoptotic cells and in cell migration. Other members of this small family of engulfment and cell motility (ELMO) proteins have been shown to interact with the dedicator of cyto-kinesis 1 protein to promote phagocytosis and effect cell shape changes.
- Poids moléculaire
- 87 kDa (MW of target protein)
-