ELMO3 anticorps (Middle Region)

N° du produit ABIN634591

Cet anticorps Lapin Polyclonal détecte spécifiquement ELMO3 dans WB. Il présente une réactivité avec des échantillons de Humain et Souris.

Aperçu rapide pour ELMO3 anticorps (Middle Region) (ABIN634591)

Antigène: ELMO3 (Engulfment and Cell Motility 3 (ELMO3))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ELMO3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ELMO3 anticorps

Épitope: Middle Region

Specificité: ELMO3 antibody was raised against the middle region of ELMO3

Purification: Affinity purified

Immunogène: ELMO3 antibody was raised using the middle region of ELMO3 corresponding to a region with amino acids RKLGFSNSNPAQDLERVPPGLLALDNMLYFSRNAPSAYSRFVLENSSRED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ELMO3 Blocking Peptide, (ABIN5613360), is also available for use as a blocking control in assays to test for specificity of this ELMO3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELMO3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ELMO3

Antigène: ELMO3 (Engulfment and Cell Motility 3 (ELMO3))

Autre désignation: ELMO3

Sujet: ELMO3 is similar to a C. elegans protein that functions in phagocytosis of apoptotic cells and in cell migration. Other members of this small family of engulfment and cell motility (ELMO) proteins have been shown to interact with the dedicator of cyto-kinesis 1 protein to promote phagocytosis and effect cell shape changes.

Poids moléculaire: 87 kDa (MW of target protein)