RPSA/Laminin Receptor anticorps (Middle Region)

N° du produit ABIN634613

Détail du produit anti-RPSA/Laminin Receptor anticorps

Antigène: RPSA/Laminin Receptor (RPSA) (Ribosomal Protein SA (RPSA))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPSA/Laminin Receptor est non-conjugé

Application: Western Blotting (WB)

Specificité: RPSA antibody was raised against the middle region of RPSA

Purification: Affinity purified

Immunogène: RPSA antibody was raised using the middle region of RPSA corresponding to a region with amino acids TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPSA Blocking Peptide, catalog no. 33R-9077, is also available for use as a blocking control in assays to test for specificity of this RPSA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPSA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPSA/Laminin Receptor

Antigène: RPSA/Laminin Receptor (RPSA) (Ribosomal Protein SA (RPSA))

Autre désignation: RPSA (RPSA Produits)

Synonymes: anticorps 37LRP, anticorps 67LR, anticorps LBP/p40, anticorps LRP/LR, anticorps LamR, anticorps rpsa, anticorps LamR1, anticorps RPSA, anticorps LAMBR, anticorps LAMR1, anticorps LBP, anticorps LRP, anticorps NEM/1CHD4, anticorps SA, anticorps lamR, anticorps p40, anticorps 67kDa, anticorps 67lr, anticorps AL022858, anticorps Lamr, anticorps Lamr1, anticorps Lamrl1, anticorps MLR, anticorps P40, anticorps P40-3, anticorps P40-8, anticorps lamr1, anticorps zgc:55831, anticorps zgc:77824, anticorps DMRT1, anticorps 40S ribosomal protein SA, anticorps 67kD laminin receptor, anticorps ribosomal protein SA, anticorps rssa, anticorps rpsa, anticorps RPSA, anticorps Rpsa, anticorps LOC100144340

Sujet: RPSA is required for the assembly and/or stability of the 40S ribosomal subunit. RPSA is also required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. RPSA plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. RPSA may play a role in cell fate determination and tissue morphogenesis.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly