Annexin IV anticorps (Middle Region)
-
- Antigène Voir toutes Annexin IV (ANXA4) Anticorps
- Annexin IV (ANXA4) (Annexin A4 (ANXA4))
-
Épitope
- Middle Region
-
Reactivité
- Chemical
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Annexin IV est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Annexin A4 antibody was raised against the middle region of ANXA4
- Réactivité croisée
- Humain
- Purification
- Affinity purified
- Immunogène
- Annexin A4 antibody was raised using the middle region of ANXA4 corresponding to a region with amino acids EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL
- Top Product
- Discover our top product ANXA4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Annexin A4 Blocking Peptide, catalog no. 33R-2421, is also available for use as a blocking control in assays to test for specificity of this Annexin A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Annexin IV (ANXA4) (Annexin A4 (ANXA4))
- Autre désignation
- Annexin A4 (ANXA4 Produits)
- Synonymes
- anticorps ANXA4, anticorps Anx4, anticorps XAnx4, anticorps pig28, anticorps X-anx4, anticorps Xanx-4, anticorps ANXIV, anticorps anx4, anticorps ANX4, anticorps PIG28, anticorps ZAP36, anticorps Annexin-4, anticorps P32.5, anticorps PAP-II, anticorps PP4-X, anticorps AI265406, anticorps AIV, anticorps AW106930, anticorps annexin A4, anticorps annexin A4 L homeolog, anticorps ANXA4, anticorps anxa4, anticorps CC1G_00713, anticorps LOC100280951, anticorps Anxa4, anticorps anxa4.L
- Classe de substances
- Chemical
- Sujet
- Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 gene has 45 to 59 % identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity.
- Poids moléculaire
- 36 kDa (MW of target protein)
-